Lineage for d1gn8a_ (1gn8 A:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 121076Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
  4. 121077Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) (S)
  5. 121153Family c.26.1.3: Adenylyltransferase [52397] (2 proteins)
  6. 121165Protein Phosphopantetheine adenylyltransferase [52398] (1 species)
  7. 121166Species Escherichia coli [TaxId:562] [52399] (3 PDB entries)
  8. 121171Domain d1gn8a_: 1gn8 A: [65395]

Details for d1gn8a_

PDB Entry: 1gn8 (more details), 1.83 Å

PDB Description: phosphopantetheine adenylyltransferase in complex with mn2+atp from escherichia coli

SCOP Domain Sequences for d1gn8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gn8a_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Escherichia coli}
mqkraiypgtfdpitnghidivtratqmfdhvilaiaaspskkpmftleervalaqqata
hlgnvevvgfsdlmanfarnqhatvlirglravadfeyemqlahmnrhlmpelesvflmp
skewsfissslvkevarhqgdvthflpenvhqalmakla

SCOP Domain Coordinates for d1gn8a_:

Click to download the PDB-style file with coordinates for d1gn8a_.
(The format of our PDB-style files is described here.)

Timeline for d1gn8a_: