Lineage for d1gm5a4 (1gm5 A:550-755)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 393331Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 393332Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 394893Family c.37.1.19: Tandem AAA-ATPase domain [81268] (9 proteins)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. 394945Protein RecG helicase domain [69494] (1 species)
  7. 394946Species Thermotoga maritima [TaxId:243274] [69495] (1 PDB entry)
  8. 394948Domain d1gm5a4: 1gm5 A:550-755 [65301]
    Other proteins in same PDB: d1gm5a1, d1gm5a2
    complexed with adp, mg

Details for d1gm5a4

PDB Entry: 1gm5 (more details), 3.24 Å

PDB Description: structure of recg bound to three-way dna junction

SCOP Domain Sequences for d1gm5a4:

Sequence, based on SEQRES records: (download)

>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima}
grkevqtmlvpmdrvnevyefvrqevmrggqafivyplieesdklnvksavemyeylske
vfpefklglmhgrlsqeekdrvmlefaegrydilvsttvievgidvpranvmvienperf
glaqlhqlrgrvgrggqeaycflvvgdvgeeamerlrfftlntdgfkiaeydlktrgpge
ffgvkqhglsgfkvadlyrdlkllew

Sequence, based on observed residues (ATOM records): (download)

>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima}
grkevqtmlvpmdrvnevyefvrqevmrggqafivypliksavemyeylskevfklglmh
grlsqeekdrvmlefaegrydilvsttvievgidvpranvmvienperfglaqlhqlrgr
vgrggqeaycflvvgdvgeeamerlrfftlntdgfkiaeydlktrgpgekqhglsgfkva
dlyrdlkllew

SCOP Domain Coordinates for d1gm5a4:

Click to download the PDB-style file with coordinates for d1gm5a4.
(The format of our PDB-style files is described here.)

Timeline for d1gm5a4: