Lineage for d1gm5a4 (1gm5 A:550-755)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 179162Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 179163Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) (S)
  5. 180169Family c.37.1.13: Extended AAA-ATPase domain [52700] (17 proteins)
  6. 180317Protein RecG helicase domain [69494] (1 species)
  7. 180318Species Thermotoga maritima [TaxId:243274] [69495] (1 PDB entry)
  8. 180320Domain d1gm5a4: 1gm5 A:550-755 [65301]
    Other proteins in same PDB: d1gm5a1, d1gm5a2

Details for d1gm5a4

PDB Entry: 1gm5 (more details), 3.24 Å

PDB Description: structure of recg bound to three-way dna junction
PDB Compounds: (A:)

SCOP Domain Sequences for d1gm5a4:

Sequence, based on SEQRES records: (download)

>d1gm5a4 c.37.1.13 (A:550-755) RecG helicase domain {Thermotoga maritima}
grkevqtmlvpmdrvnevyefvrqevmrggqafivyplieesdklnvksavemyeylske
vfpefklglmhgrlsqeekdrvmlefaegrydilvsttvievgidvpranvmvienperf
glaqlhqlrgrvgrggqeaycflvvgdvgeeamerlrfftlntdgfkiaeydlktrgpge
ffgvkqhglsgfkvadlyrdlkllew

Sequence, based on observed residues (ATOM records): (download)

>d1gm5a4 c.37.1.13 (A:550-755) RecG helicase domain {Thermotoga maritima}
grkevqtmlvpmdrvnevyefvrqevmrggqafivypliksavemyeylskevfklglmh
grlsqeekdrvmlefaegrydilvsttvievgidvpranvmvienperfglaqlhqlrgr
vgrggqeaycflvvgdvgeeamerlrfftlntdgfkiaeydlktrgpgekqhglsgfkva
dlyrdlkllew

SCOP Domain Coordinates for d1gm5a4:

Click to download the PDB-style file with coordinates for d1gm5a4.
(The format of our PDB-style files is described here.)

Timeline for d1gm5a4: