Lineage for d1gm5a2 (1gm5 A:106-285)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2790319Family b.40.4.9: RecG 'wedge' domain [69259] (1 protein)
  6. 2790320Protein RecG 'wedge' domain [69260] (1 species)
  7. 2790321Species Thermotoga maritima [TaxId:2336] [69261] (1 PDB entry)
  8. 2790322Domain d1gm5a2: 1gm5 A:106-285 [65299]
    Other proteins in same PDB: d1gm5a1, d1gm5a3, d1gm5a4
    complexed with adp, mg

Details for d1gm5a2

PDB Entry: 1gm5 (more details), 3.24 Å

PDB Description: structure of recg bound to three-way dna junction
PDB Compounds: (A:) recg

SCOPe Domain Sequences for d1gm5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gm5a2 b.40.4.9 (A:106-285) RecG 'wedge' domain {Thermotoga maritima [TaxId: 2336]}
csgeevdlstdiqyakgvgpnrkkklkklgietlrdlleffprdyedrrkifklndllpg
ekvttqgkivsvetkkfqnmniltavlsdglvhvplkwfnqdylqtylkqltgkevfvtg
tvksnaytgqyeihnaevtpkegeyvrrilpiyrltsgisqkqmrkifeenipslccslk

SCOPe Domain Coordinates for d1gm5a2:

Click to download the PDB-style file with coordinates for d1gm5a2.
(The format of our PDB-style files is described here.)

Timeline for d1gm5a2: