Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.9: RecG 'wedge' domain [69259] (1 protein) |
Protein RecG 'wedge' domain [69260] (1 species) |
Species Thermotoga maritima [TaxId:2336] [69261] (1 PDB entry) |
Domain d1gm5a2: 1gm5 A:106-285 [65299] Other proteins in same PDB: d1gm5a1, d1gm5a3, d1gm5a4 complexed with adp, mg |
PDB Entry: 1gm5 (more details), 3.24 Å
SCOPe Domain Sequences for d1gm5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gm5a2 b.40.4.9 (A:106-285) RecG 'wedge' domain {Thermotoga maritima [TaxId: 2336]} csgeevdlstdiqyakgvgpnrkkklkklgietlrdlleffprdyedrrkifklndllpg ekvttqgkivsvetkkfqnmniltavlsdglvhvplkwfnqdylqtylkqltgkevfvtg tvksnaytgqyeihnaevtpkegeyvrrilpiyrltsgisqkqmrkifeenipslccslk
Timeline for d1gm5a2: