Lineage for d1gm5a1 (1gm5 A:7-105)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 212790Fold a.29: Bromodomain-like [47363] (4 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 212850Superfamily a.29.4: RecG, N-terminal domain [69008] (1 family) (S)
  5. 212851Family a.29.4.1: RecG, N-terminal domain [69009] (1 protein)
  6. 212852Protein RecG, N-terminal domain [69010] (1 species)
  7. 212853Species Thermotoga maritima [TaxId:243274] [69011] (1 PDB entry)
  8. 212854Domain d1gm5a1: 1gm5 A:7-105 [65298]
    Other proteins in same PDB: d1gm5a2, d1gm5a3, d1gm5a4
    complexed with adp, mg

Details for d1gm5a1

PDB Entry: 1gm5 (more details), 3.24 Å

PDB Description: structure of recg bound to three-way dna junction

SCOP Domain Sequences for d1gm5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gm5a1 a.29.4.1 (A:7-105) RecG, N-terminal domain {Thermotoga maritima}
ftsslflwgealptlleeflnevekmlknqvntrrihqllkelddpllenkdleeklqaf
ldyvkeipnlpearkryriqkslemieklrswflidyle

SCOP Domain Coordinates for d1gm5a1:

Click to download the PDB-style file with coordinates for d1gm5a1.
(The format of our PDB-style files is described here.)

Timeline for d1gm5a1: