![]() | Class a: All alpha proteins [46456] (226 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (1 family) ![]() the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity |
![]() | Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (5 proteins) |
![]() | Protein Moth pheromone-binding protein, PBP [47569] (2 species) |
![]() | Species Silk moth (Bombyx mori) [TaxId:7091] [47570] (3 PDB entries) |
![]() | Domain d1gm0a_: 1gm0 A: [65297] |
PDB Entry: 1gm0 (more details)
SCOP Domain Sequences for d1gm0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gm0a_ a.39.2.1 (A:) Moth pheromone-binding protein, PBP {Silk moth (Bombyx mori)} sqevmknlslnfgkaldeckkemtltdainedfynfwkegyeiknretgcaimclstkln mldpegnlhhgnamefakkhgadetmaqqlidivhgcekstpanddkciwtlgvatcfka eihklnwapsmdvavgeilaev
Timeline for d1gm0a_: