Lineage for d1gm0a_ (1gm0 A:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 152429Fold a.39: EF Hand-like [47472] (4 superfamilies)
  4. 152864Superfamily a.39.2: Insect pheromon/odorant-binding proteins [47565] (1 family) (S)
  5. 152865Family a.39.2.1: Insect pheromon/odorant-binding proteins [47566] (2 proteins)
  6. 152866Protein Pheromone binding protein [47569] (1 species)
  7. 152867Species Silkworm (Bombyx mori) [TaxId:7091] [47570] (2 PDB entries)
  8. 152870Domain d1gm0a_: 1gm0 A: [65297]

Details for d1gm0a_

PDB Entry: 1gm0 (more details)

PDB Description: a form of the pheromone-binding protein from bombyx mori

SCOP Domain Sequences for d1gm0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gm0a_ a.39.2.1 (A:) Pheromone binding protein {Silkworm (Bombyx mori)}
sqevmknlslnfgkaldeckkemtltdainedfynfwkegyeiknretgcaimclstkln
mldpegnlhhgnamefakkhgadetmaqqlidivhgcekstpanddkciwtlgvatcfka
eihklnwapsmdvavgeilaev

SCOP Domain Coordinates for d1gm0a_:

Click to download the PDB-style file with coordinates for d1gm0a_.
(The format of our PDB-style files is described here.)

Timeline for d1gm0a_: