SCOPe 2.07: Domain d1gl9b2: 1gl9 B:251-498

Lineage for d1gl9b2 (1gl9 B:251-498)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.16: Helicase-like "domain" of reverse gyrase [69496] (1 protein)

6. Protein Helicase-like "domain" of reverse gyrase [69497] (1 species)
   contains a mobile insertion of LEM/SAP-like HeH motif, residues 354-423

7. Species Archaeoglobus fulgidus [TaxId:2234] [69498] (2 PDB entries)

8. Domain d1gl9b2: 1gl9 B:251-498 [65292]
   Other proteins in same PDB: d1gl9b3, d1gl9c3
   protein/DNA complex; complexed with anp, mg

Details for d1gl9b2

PDB Entry: 1gl9, 3.2 Å

PDB Description: archaeoglobus fulgidus reverse gyrase complexed with adpnp

PDB Compounds: (B:) reverse gyrase

SCOPe Domain Sequences for d1gl9b2:

Sequence; same for both SEQRES and ATOM records:

>d1gl9b2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeoglobus fulgidus [TaxId: 2234]}
vrnvedvavndesistlssileklgtggiiyartgeeaeeiyeslknkfrigivtatkkg
dyekfvegeidhligtahyygtlvrgldlperirfavfvgcpsfrvtiedidslspqmvk
llaylyrnvdeierllpaverhidevreilkkvmgkerpqakdvvvregevifpdlrtyi
qgsgrtsrlfaggltkgasflleddsellsafieraklydiefksidevdfeklsrelde
srdryrrr

Timeline for d1gl9b2:

• d1gl9b2 first appeared in SCOP 1.59
  
• d1gl9b2 appears in SCOPe 2.06
  
• d1gl9b2 appears in the current release, SCOPe 2.08