Lineage for d1gl8a_ (1gl8 A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 395822Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 395823Superfamily c.47.1: Thioredoxin-like [52833] (14 families) (S)
  5. 395824Family c.47.1.1: Thioltransferase [52834] (9 proteins)
  6. 395871Protein Thioredoxin [52835] (9 species)
  7. 395949Species Spinach (Spinacia oleracea), thioredoxin M [TaxId:3562] [52841] (3 PDB entries)
  8. 395954Domain d1gl8a_: 1gl8 A: [65290]

Details for d1gl8a_

PDB Entry: 1gl8 (more details)

PDB Description: solution structure of thioredoxin m from spinach, oxidized form

SCOP Domain Sequences for d1gl8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gl8a_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin M}
vqdvndsswkefvlesevpvmvdfwapwcgpckliapvidelakeysgkiavyklntdea
pgiatqynirsiptvlffkngerkesiigavpkstltdsiekyl

SCOP Domain Coordinates for d1gl8a_:

Click to download the PDB-style file with coordinates for d1gl8a_.
(The format of our PDB-style files is described here.)

Timeline for d1gl8a_: