Lineage for d1gk8m_ (1gk8 M:)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.73: RuBisCO, small subunit [55238] (1 superfamily) Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) 
Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein) Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (6 species) Species Chlamydomonas reinhardtii [TaxId:3055] [69758] (2 PDB entries) 
Domain d1gk8m_: 1gk8 M: [65244]
Other proteins in same PDB: d1gk8a1, d1gk8a2, d1gk8c1, d1gk8c2, d1gk8e1, d1gk8e2, d1gk8g1, d1gk8g2
Details for d1gk8m_
PDB Entry: 1gk8 (more details), 1.4 Å
PDB Description: rubisco from chlamydomonas reinhardtii
SCOP Domain Sequences for d1gk8m_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gk8m_ d.73.1.1 (M:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlamydomonas reinhardtii}
mvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairfg
svsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimgf
lvqrp
SCOP Domain Coordinates for d1gk8m_:
Click to download the PDB-style file with coordinates for d1gk8m_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gk8m_:
- d1gk8m_ first appeared in SCOP 1.59
- d1gk8m_ appears in SCOP 1.63
- d1gk8m_ appears in the current release, SCOPe 2.08
View in 3D
