Lineage for d1gk8i_ (1gk8 I:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2524228Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 2524229Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) (S)
  5. 2524230Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)
  6. 2524231Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (8 species)
  7. 2524250Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [69758] (6 PDB entries)
  8. 2524267Domain d1gk8i_: 1gk8 I: [65242]
    Other proteins in same PDB: d1gk8a1, d1gk8a2, d1gk8c1, d1gk8c2, d1gk8e1, d1gk8e2, d1gk8g1, d1gk8g2
    complexed with cap, edo, mg

Details for d1gk8i_

PDB Entry: 1gk8 (more details), 1.4 Å

PDB Description: rubisco from chlamydomonas reinhardtii
PDB Compounds: (I:) ribulose bisphosphate carboxylase small chain 1

SCOPe Domain Sequences for d1gk8i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gk8i_ d.73.1.1 (I:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairf
gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
flvqrp

SCOPe Domain Coordinates for d1gk8i_:

Click to download the PDB-style file with coordinates for d1gk8i_.
(The format of our PDB-style files is described here.)

Timeline for d1gk8i_: