Lineage for d1gi8.1 (1gi8 A:,B:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1318222Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1318223Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1318445Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 1319884Protein Urokinase-type plasminogen activator (LMW U-PA), catalytic domain [50586] (1 species)
  7. 1319885Species Human (Homo sapiens) [TaxId:9606] [50587] (63 PDB entries)
    Uniprot P00749 156-178,179-424
  8. 1319909Domain d1gi8.1: 1gi8 A:,B: [65215]
    complexed with bmz, cit

Details for d1gi8.1

PDB Entry: 1gi8 (more details), 1.75 Å

PDB Description: a novel serine protease inhibition motif involving a multi-centered short hydrogen bonding network at the active site
PDB Compounds: (A:) urokinase-type plasminogen activator, (B:) urokinase-type plasminogen activator

SCOPe Domain Sequences for d1gi8.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1gi8.1 b.47.1.2 (A:,B:) Urokinase-type plasminogen activator (LMW U-PA), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
lkfqcgqktXiiggefttienqpwfaaiyrrhrggsvtyvcggslmspcwvisathcfid
ypkkedyivylgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrc
aqpsrtiqticlpsmyndpqfgtsceitgfgkeastdylypeqlkmtvvklishrecqqp
hyygsevttkmlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgv
ytrvshflpwirsht

SCOPe Domain Coordinates for d1gi8.1:

Click to download the PDB-style file with coordinates for d1gi8.1.
(The format of our PDB-style files is described here.)

Timeline for d1gi8.1: