SCOP 1.75: Domain d1gehc2: 1geh C:12-136

Lineage for d1gehc2 (1geh C:12-136)

Root: SCOP 1.75
Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family)
C-terminal domain is beta/alpha barrel
Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species)
Species Archaeon Thermococcus kodakaraensis [TaxId:311400] [69731] (1 PDB entry)
Domain d1gehc2: 1geh C:12-136 [65186]
Other proteins in same PDB: d1geha1, d1gehb1, d1gehc1, d1gehd1, d1gehe1

Details for d1gehc2

PDB Entry: 1geh (more details), 2.8 Å

PDB Description: crystal structure of archaeal rubisco (ribulose 1,5-bisphosphate carboxylase/oxygenase)

PDB Compounds: (C:) ribulose-1,5-bisphosphate carboxylase/oxygenase

SCOP Domain Sequences for d1gehc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gehc2 d.58.9.1 (C:12-136) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Archaeon Thermococcus kodakaraensis [TaxId: 311400]}
yvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlypwyeqerwadls
akaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkglrledlyfpek
liref

SCOP Domain Coordinates for d1gehc2:

Click to download the PDB-style file with coordinates for d1gehc2.
(The format of our PDB-style files is described here.)

Timeline for d1gehc2: