SCOP 1.59: Domain d1gehc2: 1geh C:12-136

Lineage for d1gehc2 (1geh C:12-136)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.58: Ferredoxin-like [54861] (39 superfamilies)

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family)

5. Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (8 species)

7. Species Archaeon Thermococcus kodakaraensis [TaxId:311400] [69731] (1 PDB entry)

8. Domain d1gehc2: 1geh C:12-136 [65186]
   Other proteins in same PDB: d1geha1, d1gehb1, d1gehc1, d1gehd1, d1gehe1

Details for d1gehc2

PDB Entry: 1geh, 2.8 Å

PDB Description: crystal structure of archaeal rubisco (ribulose 1,5-bisphosphate carboxylase/oxygenase)

SCOP Domain Sequences for d1gehc2:

Sequence; same for both SEQRES and ATOM records:

>d1gehc2 d.58.9.1 (C:12-136) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Archaeon Thermococcus kodakaraensis}
yvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlypwyeqerwadls
akaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkglrledlyfpek
liref

Timeline for d1gehc2:

• d1gehc2 is new in SCOP 1.59
  
• d1gehc2 appears in SCOP 1.61
  
• d1gehc2 appears in the current release, SCOPe 2.08