Lineage for d1gehc1 (1geh C:137-443)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 115904Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 117501Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (1 family) (S)
  5. 117502Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (1 protein)
  6. 117503Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (8 species)
  7. 117509Species Archaeon Thermococcus kodakaraensis [TaxId:311400] [69404] (1 PDB entry)
  8. 117512Domain d1gehc1: 1geh C:137-443 [65185]
    Other proteins in same PDB: d1geha2, d1gehb2, d1gehc2, d1gehd2, d1gehe2

Details for d1gehc1

PDB Entry: 1geh (more details), 2.8 Å

PDB Description: crystal structure of archaeal rubisco (ribulose 1,5-bisphosphate carboxylase/oxygenase)

SCOP Domain Sequences for d1gehc1:

Sequence, based on SEQRES records: (download)

>d1gehc1 c.1.14.1 (C:137-443) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Archaeon Thermococcus kodakaraensis}
dgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydllsngadymkddenlts
pwynrfeeraeimakiidkvenetgekktwfanitadllemeqrlevladlglkhamvdv
vitgwgalryirdlaadyglaihghramhaaftrnpyhgismfvlaklyrligidqlhvg
tagagkleggkwdviqnarilreshykpdendvfhleqkfysikaafptssgglhpgniq
pviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgipldeyakthkelarale
kwghvtp

Sequence, based on observed residues (ATOM records): (download)

>d1gehc1 c.1.14.1 (C:137-443) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Archaeon Thermococcus kodakaraensis}
dgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydllsngadymkddenlts
pwynrfeeraeimakiidkvenetgekktwfanitadllemeqrlevladlglkhamvdv
vitgwgalryirdlaadyglaihghramhaaftrnpyhgismfvlaklyrligidqlhvg
taeggkwdviqnarilreshykpdendvfhleqkfysikaafptssgglhpgniqpviea
lgtdivlqlgggtlghpdgpaagaravrqaidaimqgipldeyakthkelaralekwghv
tp

SCOP Domain Coordinates for d1gehc1:

Click to download the PDB-style file with coordinates for d1gehc1.
(The format of our PDB-style files is described here.)

Timeline for d1gehc1: