Lineage for d1gehb2 (1geh B:12-136)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 191935Fold d.58: Ferredoxin-like [54861] (40 superfamilies)
  4. 192424Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) (S)
  5. 192425Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 192426Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (8 species)
  7. 192432Species Archaeon Thermococcus kodakaraensis [TaxId:311400] [69731] (1 PDB entry)
  8. 192434Domain d1gehb2: 1geh B:12-136 [65184]
    Other proteins in same PDB: d1geha1, d1gehb1, d1gehc1, d1gehd1, d1gehe1

Details for d1gehb2

PDB Entry: 1geh (more details), 2.8 Å

PDB Description: crystal structure of archaeal rubisco (ribulose 1,5-bisphosphate carboxylase/oxygenase)

SCOP Domain Sequences for d1gehb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gehb2 d.58.9.1 (B:12-136) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Archaeon Thermococcus kodakaraensis}
yvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlypwyeqerwadls
akaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkglrledlyfpek
liref

SCOP Domain Coordinates for d1gehb2:

Click to download the PDB-style file with coordinates for d1gehb2.
(The format of our PDB-style files is described here.)

Timeline for d1gehb2: