Lineage for d1gdga1 (1gdg A:1-132)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 190970Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
  4. 190971Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (5 families) (S)
  5. 191025Family d.32.1.3: Extradiol dioxygenases [54602] (3 proteins)
  6. 191026Protein 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) [54603] (2 species)
  7. 191036Species Pseudomonas sp. [TaxId:306] [54604] (6 PDB entries)
  8. 191037Domain d1gdga1: 1gdg A:1-132 [65179]

Details for d1gdga1

PDB Entry: 1gdg (more details), 2 Å

PDB Description: crystal structure of 2,3-dihydroxybiphenyl 1,2-dioxygenase in complex with 2,3-dhbp and no

SCOP Domain Sequences for d1gdga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gdga1 d.32.1.3 (A:1-132) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Pseudomonas sp.}
sierlgylgfavkdvpawdhfltksvglmaagsagdaalyradqrawriavqpgelddla
yaglevddaaalermadklrqagvaftrgdealmqqrkvmgllclqdpfglpleiyygpa
eifhepflpsap

SCOP Domain Coordinates for d1gdga1:

Click to download the PDB-style file with coordinates for d1gdga1.
(The format of our PDB-style files is described here.)

Timeline for d1gdga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gdga2