Lineage for d1g5aa1 (1g5a A:555-628)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 469403Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 469404Superfamily b.71.1: Glycosyl hydrolase domain [51011] (3 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 469405Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 469422Protein Amylosucrase [69328] (1 species)
  7. 469423Species Neisseria polysaccharea [TaxId:489] [69329] (9 PDB entries)
  8. 469424Domain d1g5aa1: 1g5a A:555-628 [65152]
    Other proteins in same PDB: d1g5aa2

Details for d1g5aa1

PDB Entry: 1g5a (more details), 1.4 Å

PDB Description: amylosucrase from neisseria polysaccharea

SCOP Domain Sequences for d1g5aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g5aa1 b.71.1.1 (A:555-628) Amylosucrase {Neisseria polysaccharea}
rlvtfntnnkhiigyirnnallafgnfseypqtvtahtlqampfkahdliggktvslnqd
ltlqpyqvmwleia

SCOP Domain Coordinates for d1g5aa1:

Click to download the PDB-style file with coordinates for d1g5aa1.
(The format of our PDB-style files is described here.)

Timeline for d1g5aa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1g5aa2