Lineage for d1g50a_ (1g50 A:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 217440Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 217441Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 217442Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (20 proteins)
  6. 217450Protein Estrogen receptor alpha [48519] (1 species)
  7. 217451Species Human (Homo sapiens) [TaxId:9606] [48520] (11 PDB entries)
  8. 217472Domain d1g50a_: 1g50 A: [65149]

Details for d1g50a_

PDB Entry: 1g50 (more details), 2.9 Å

PDB Description: crystal structure of a wild type her alpha lbd at 2.9 angstrom resolution

SCOP Domain Sequences for d1g50a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g50a_ a.123.1.1 (A:) Estrogen receptor alpha {Human (Homo sapiens)}
nslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakr
vpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmve
ifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkit
dtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydlllem
ldahrlh

SCOP Domain Coordinates for d1g50a_:

Click to download the PDB-style file with coordinates for d1g50a_.
(The format of our PDB-style files is described here.)

Timeline for d1g50a_: