SCOP 1.73: Domain d1g4mb2: 1g4m B:176-393

Lineage for d1g4mb2 (1g4m B:176-393)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (20 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.11: Arrestin [81291] (1 protein)

6. Protein Arrestin [49244] (2 species)
   duplication: contains tandem repeat of two elaborated Ig-like domains contacting each other head-to-head

7. Species Cow (Bos taurus), beta-arrestin 1 [TaxId:9913] [69169] (4 PDB entries)

8. Domain d1g4mb2: 1g4m B:176-393 [65146]
   mutant

Details for d1g4mb2

PDB Entry: 1g4m, 1.9 Å

PDB Description: crystal structure of bovine beta-arrestin 1

PDB Compounds: (B:) beta-arrestin1

SCOP Domain Sequences for d1g4mb2:

Sequence, based on SEQRES records:

>d1g4mb2 b.1.18.11 (B:176-393) Arrestin {Cow (Bos taurus), beta-arrestin 1 [TaxId: 9913]}
erpgpqptaettrqflmsdkplhleasldkeiyyhgepisvnvhvtnntnktvkkikisv
rqyadiclfntaqykcpvameeaddtvapsstfckvytltpflannrekrglaldgklkh
edtnlasstllreganreilgiivsykvkvklvvsrggllgdlassdvavelpftlmhpk
pkeepphrevpehetpvdtnlieldtndddivfedfar

Sequence, based on observed residues (ATOM records):

>d1g4mb2 b.1.18.11 (B:176-393) Arrestin {Cow (Bos taurus), beta-arrestin 1 [TaxId: 9913]}
erpgpqptaettrqflmsdkplhleasldkeiyyhgepisvnvhvtnntnktvkkikisv
rqyadiclfntaqykcpvameeaddtvapsstfckvytltpflannrekrglaldgklkh
edtnlasstllreganreilgiivsykvkvklvvsrassdvavelpftlmhpkpkdddiv
fedfar

Timeline for d1g4mb2:

• d1g4mb2 first appeared in SCOP 1.59
  
• d1g4mb2 appears in SCOP 1.71
  
• d1g4mb2 appears in SCOP 1.75
  
• d1g4mb2 appears in the current release, SCOPe 2.08