Lineage for d1g4mb2 (1g4m B:176-393)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 456110Superfamily b.1.18: E set domains [81296] (18 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 456536Family b.1.18.11: Arrestin [81291] (1 protein)
  6. 456537Protein Arrestin [49244] (2 species)
    duplication: contains tandem repeat of two elaborated Ig-like domains contacting each other head-to-head
  7. 456538Species Cow (Bos taurus), beta-arrestin 1 [TaxId:9913] [69169] (3 PDB entries)
  8. 456542Domain d1g4mb2: 1g4m B:176-393 [65146]

Details for d1g4mb2

PDB Entry: 1g4m (more details), 1.9 Å

PDB Description: crystal structure of bovine beta-arrestin 1

SCOP Domain Sequences for d1g4mb2:

Sequence, based on SEQRES records: (download)

>d1g4mb2 b.1.18.11 (B:176-393) Arrestin {Cow (Bos taurus), beta-arrestin 1}
erpgpqptaettrqflmsdkplhleasldkeiyyhgepisvnvhvtnntnktvkkikisv
rqyadiclfntaqykcpvameeaddtvapsstfckvytltpflannrekrglaldgklkh
edtnlasstllreganreilgiivsykvkvklvvsrggllgdlassdvavelpftlmhpk
pkeepphrevpehetpvdtnlieldtndddivfedfar

Sequence, based on observed residues (ATOM records): (download)

>d1g4mb2 b.1.18.11 (B:176-393) Arrestin {Cow (Bos taurus), beta-arrestin 1}
erpgpqptaettrqflmsdkplhleasldkeiyyhgepisvnvhvtnntnktvkkikisv
rqyadiclfntaqykcpvameeaddtvapsstfckvytltpflannrekrglaldgklkh
edtnlasstllreganreilgiivsykvkvklvvsrassdvavelpftlmhpkpkdddiv
fedfar

SCOP Domain Coordinates for d1g4mb2:

Click to download the PDB-style file with coordinates for d1g4mb2.
(The format of our PDB-style files is described here.)

Timeline for d1g4mb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1g4mb1