SCOP 1.65: Domain d1g4mb1: 1g4m B:5-175

Lineage for d1g4mb1 (1g4m B:5-175)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (18 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.11: Arrestin [81291] (1 protein)

6. Protein Arrestin [49244] (2 species)
   duplication: contains tandem repeat of two elaborated Ig-like domains contacting each other head-to-head

7. Species Cow (Bos taurus), beta-arrestin 1 [TaxId:9913] [69169] (3 PDB entries)

8. Domain d1g4mb1: 1g4m B:5-175 [65145]

Details for d1g4mb1

PDB Entry: 1g4m, 1.9 Å

PDB Description: crystal structure of bovine beta-arrestin 1

SCOP Domain Sequences for d1g4mb1:

Sequence; same for both SEQRES and ATOM records:

>d1g4mb1 b.1.18.11 (B:5-175) Arrestin {Cow (Bos taurus), beta-arrestin 1}
gtrvfkkaspngkltvylgkrdfvdhidlvepvdgvvlvdpeylkerrvyvtltcafryg
redldvlgltfrkdlfvanvqsfppapedkkpltrlqerlikklgehaypftfeippnlp
csvtlqpgpedtgkacgvdyevkafcaenleekihkrnsvrlvirkvqyap

Timeline for d1g4mb1:

• d1g4mb1 first appeared in SCOP 1.59
  
• d1g4mb1 appears in SCOP 1.63
  
• d1g4mb1 appears in SCOP 1.67
  
• d1g4mb1 appears in the current release, SCOPe 2.08