Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (6 families) |
Family d.169.1.1: C-type lectin domain [56437] (26 proteins) Pfam 00059 |
Protein E-selectin, C-lectin domain [56456] (1 species) folowed by EGF-like module |
Species Human (Homo sapiens) [TaxId:9606] [56457] (2 PDB entries) |
Domain d1g1ta1: 1g1t A:1-118 [65104] Other proteins in same PDB: d1g1ta2 complexed with 1na, ca, fuc, gal, sia |
PDB Entry: 1g1t (more details), 1.5 Å
SCOP Domain Sequences for d1g1ta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g1ta1 d.169.1.1 (A:1-118) E-selectin, C-lectin domain {Human (Homo sapiens)} wsyntsteamtydeasaycqqrythlvaiqnkeeieylnsilsyspsyywigirkvnnvw vwvgtqkplteeaknwapgepnnrqkdedcveiyikrekdvgmwndercskkklalcy
Timeline for d1g1ta1: