Lineage for d1g1ta1 (1g1t A:1-118)
- Root: SCOP 1.59
Class d: Alpha and beta proteins (a+b) [53931] (208 folds) 
Fold d.169: C-type lectin-like [56435] (1 superfamily) Superfamily d.169.1: C-type lectin-like [56436] (5 families) 
Family d.169.1.1: C-type lectin domain [56437] (17 proteins) 
Protein E-selectin [56456] (1 species) Species Human (Homo sapiens) [TaxId:9606] [56457] (5 PDB entries) 
Domain d1g1ta1: 1g1t A:1-118 [65104]
Other proteins in same PDB: d1g1ta2
Details for d1g1ta1
PDB Entry: 1g1t (more details), 1.5 Å
PDB Description: crystal structure of e-selectin lectin/egf domains complexed with slex
SCOP Domain Sequences for d1g1ta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g1ta1 d.169.1.1 (A:1-118) E-selectin {Human (Homo sapiens)}
wsyntsteamtydeasaycqqrythlvaiqnkeeieylnsilsyspsyywigirkvnnvw
vwvgtqkplteeaknwapgepnnrqkdedcveiyikrekdvgmwndercskkklalcy
SCOP Domain Coordinates for d1g1ta1:
Click to download the PDB-style file with coordinates for d1g1ta1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1g1ta1:
- d1g1ta1 is new in SCOP 1.59
- d1g1ta1 appears in SCOP 1.61
- d1g1ta1 appears in the current release, SCOPe 2.08
View in 3D
