SCOPe 2.08: Domain d1g1ta1: 1g1t A:1-118

Lineage for d1g1ta1 (1g1t A:1-118)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
   Pfam PF00059

6. Protein E-selectin, C-lectin domain [56456] (1 species)
   folowed by EGF-like module

7. Species Human (Homo sapiens) [TaxId:9606] [56457] (2 PDB entries)

8. Domain d1g1ta1: 1g1t A:1-118 [65104]
   Other proteins in same PDB: d1g1ta2
   complexed with ca

Details for d1g1ta1

PDB Entry: 1g1t, 1.5 Å

PDB Description: crystal structure of e-selectin lectin/egf domains complexed with slex

PDB Compounds: (A:) e-selectin

SCOPe Domain Sequences for d1g1ta1:

Sequence; same for both SEQRES and ATOM records:

>d1g1ta1 d.169.1.1 (A:1-118) E-selectin, C-lectin domain {Human (Homo sapiens) [TaxId: 9606]}
wsyntsteamtydeasaycqqrythlvaiqnkeeieylnsilsyspsyywigirkvnnvw
vwvgtqkplteeaknwapgepnnrqkdedcveiyikrekdvgmwndercskkklalcy

Timeline for d1g1ta1:

• d1g1ta1 first appeared in SCOP 1.59
  
• d1g1ta1 appears in SCOPe 2.07