SCOPe 2.02: Domain d1g1sa1: 1g1s A:1-118

Lineage for d1g1sa1 (1g1s A:1-118)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
   Pfam PF00059

6. Protein P-selectin, C-lectin domain [116731] (1 species)
   followed by EGF-like module

7. Species Human (Homo sapiens) [TaxId:9606] [116732] (3 PDB entries)

8. Domain d1g1sa1: 1g1s A:1-118 [65100]
   Other proteins in same PDB: d1g1sa2, d1g1sb2
   complexed with psgl-1 peptide
   complexed with mrd, na, sr

Details for d1g1sa1

PDB Entry: 1g1s, 1.9 Å

PDB Description: p-selectin lectin/egf domains complexed with psgl-1 peptide

PDB Compounds: (A:) p-selectin

SCOPe Domain Sequences for d1g1sa1:

Sequence; same for both SEQRES and ATOM records:

>d1g1sa1 d.169.1.1 (A:1-118) P-selectin, C-lectin domain {Human (Homo sapiens) [TaxId: 9606]}
wtyhystkayswnisrkycqnrytdlvaiqnkneidylnkvlpyyssyywigirknnktw
twvgtkkaltneaenwadnepnnkrnnedcveiyikspsapgkwndehclkkkhalcy

Timeline for d1g1sa1:

• d1g1sa1 first appeared in SCOP 1.59
  
• d1g1sa1 appears in SCOPe 2.01
  
• d1g1sa1 appears in SCOPe 2.03
  
• d1g1sa1 appears in the current release, SCOPe 2.08