Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
Protein P-selectin, C-lectin domain [116731] (1 species) followed by EGF-like module |
Species Human (Homo sapiens) [TaxId:9606] [116732] (3 PDB entries) |
Domain d1g1sa1: 1g1s A:1-118 [65100] Other proteins in same PDB: d1g1sa2, d1g1sb2 complexed with psgl-1 peptide complexed with mrd, na, sr |
PDB Entry: 1g1s (more details), 1.9 Å
SCOPe Domain Sequences for d1g1sa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g1sa1 d.169.1.1 (A:1-118) P-selectin, C-lectin domain {Human (Homo sapiens) [TaxId: 9606]} wtyhystkayswnisrkycqnrytdlvaiqnkneidylnkvlpyyssyywigirknnktw twvgtkkaltneaenwadnepnnkrnnedcveiyikspsapgkwndehclkkkhalcy
Timeline for d1g1sa1: