Lineage for d1g1rd2 (1g1r D:119-160)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 888904Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 889622Superfamily g.3.11: EGF/Laminin [57196] (7 families) (S)
  5. 889623Family g.3.11.1: EGF-type module [57197] (22 proteins)
  6. 889668Protein E-selectin, EGF-domain [57203] (1 species)
  7. 889669Species Human (Homo sapiens) [TaxId:9606] [57204] (5 PDB entries)
  8. 889681Domain d1g1rd2: 1g1r D:119-160 [65099]
    Other proteins in same PDB: d1g1ra1, d1g1rb1, d1g1rc1, d1g1rd1
    complexed with 1na, ca, fuc, gal, mpd, sia

Details for d1g1rd2

PDB Entry: 1g1r (more details), 3.4 Å

PDB Description: crystal structure of p-selectin lectin/egf domains complexed with slex
PDB Compounds: (D:) p-selectin

SCOP Domain Sequences for d1g1rd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g1rd2 g.3.11.1 (D:119-160) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]}
tascqdmscskqgecletignytcscypgfygpeceyvrddd

SCOP Domain Coordinates for d1g1rd2:

Click to download the PDB-style file with coordinates for d1g1rd2.
(The format of our PDB-style files is described here.)

Timeline for d1g1rd2: