Lineage for d1g1rd1 (1g1r D:1-118)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 139425Fold d.169: C-type lectin-like [56435] (1 superfamily)
  4. 139426Superfamily d.169.1: C-type lectin-like [56436] (5 families) (S)
  5. 139427Family d.169.1.1: C-type lectin domain [56437] (17 proteins)
  6. 139453Protein E-selectin [56456] (1 species)
  7. 139454Species Human (Homo sapiens) [TaxId:9606] [56457] (5 PDB entries)
  8. 139466Domain d1g1rd1: 1g1r D:1-118 [65098]
    Other proteins in same PDB: d1g1ra2, d1g1rb2, d1g1rc2, d1g1rd2

Details for d1g1rd1

PDB Entry: 1g1r (more details), 3.4 Å

PDB Description: crystal structure of p-selectin lectin/egf domains complexed with slex

SCOP Domain Sequences for d1g1rd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g1rd1 d.169.1.1 (D:1-118) E-selectin {Human (Homo sapiens)}
wtyhystkayswnisrkycqnrytdlvaiqnkneidylnkvlpyyssyywigirknnktw
twvgtkkaltneaenwadnepnnkrnnedcveiyikspsapgkwndehclkkkhalcy

SCOP Domain Coordinates for d1g1rd1:

Click to download the PDB-style file with coordinates for d1g1rd1.
(The format of our PDB-style files is described here.)

Timeline for d1g1rd1: