Lineage for d1g1qc2 (1g1q C:119-158)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634700Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2635893Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2635894Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 2636047Protein E-selectin, EGF-domain [57203] (1 species)
  7. 2636048Species Human (Homo sapiens) [TaxId:9606] [57204] (5 PDB entries)
  8. 2636054Domain d1g1qc2: 1g1q C:119-158 [65089]
    Other proteins in same PDB: d1g1qa1, d1g1qa3, d1g1qb1, d1g1qb3, d1g1qc1, d1g1qc3, d1g1qd1, d1g1qd3
    complexed with ca, mrd

Details for d1g1qc2

PDB Entry: 1g1q (more details), 2.4 Å

PDB Description: Crystal structure of P-selectin lectin/EGF domains
PDB Compounds: (C:) p-selectin

SCOPe Domain Sequences for d1g1qc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g1qc2 g.3.11.1 (C:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]}
tascqdmscskqgecletignytcscypgfygpeceyvrd

SCOPe Domain Coordinates for d1g1qc2:

Click to download the PDB-style file with coordinates for d1g1qc2.
(The format of our PDB-style files is described here.)

Timeline for d1g1qc2: