Class g: Small proteins [56992] (79 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (6 families) |
Family g.3.11.1: EGF-type module [57197] (22 proteins) |
Protein E-selectin, EGF-domain [57203] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57204] (5 PDB entries) |
Domain d1g1qc2: 1g1q C:119-159 [65089] Other proteins in same PDB: d1g1qa1, d1g1qb1, d1g1qc1, d1g1qd1 |
PDB Entry: 1g1q (more details), 2.4 Å
SCOP Domain Sequences for d1g1qc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g1qc2 g.3.11.1 (C:119-159) E-selectin, EGF-domain {Human (Homo sapiens)} tascqdmscskqgecletignytcscypgfygpeceyvrdd
Timeline for d1g1qc2: