Lineage for d1g1qc1 (1g1q C:1-118)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 614335Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 614336Superfamily d.169.1: C-type lectin-like [56436] (6 families) (S)
  5. 614337Family d.169.1.1: C-type lectin domain [56437] (26 proteins)
    Pfam 00059
  6. 614558Protein P-selectin, C-lectin domain [116731] (1 species)
    followed by EGF-like module
  7. 614559Species Human (Homo sapiens) [TaxId:9606] [116732] (3 PDB entries)
  8. 614564Domain d1g1qc1: 1g1q C:1-118 [65088]
    Other proteins in same PDB: d1g1qa2, d1g1qb2, d1g1qc2, d1g1qd2

Details for d1g1qc1

PDB Entry: 1g1q (more details), 2.4 Å

PDB Description: Crystal structure of P-selectin lectin/EGF domains

SCOP Domain Sequences for d1g1qc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g1qc1 d.169.1.1 (C:1-118) P-selectin, C-lectin domain {Human (Homo sapiens)}
wtyhystkayswnisrkycqnrytdlvaiqnkneidylnkvlpyyssyywigirknnktw
twvgtkkaltneaenwadnepnnkrnnedcveiyikspsapgkwndehclkkkhalcy

SCOP Domain Coordinates for d1g1qc1:

Click to download the PDB-style file with coordinates for d1g1qc1.
(The format of our PDB-style files is described here.)

Timeline for d1g1qc1: