SCOP 1.67: Domain d1g1qc1: 1g1q C:1-118

Lineage for d1g1qc1 (1g1q C:1-118)

Root: SCOP 1.67
Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
Fold d.169: C-type lectin-like [56435] (1 superfamily)
unusual fold
Superfamily d.169.1: C-type lectin-like [56436] (6 families)
Family d.169.1.1: C-type lectin domain [56437] (22 proteins)
Protein E-selectin [56456] (1 species)
also contains EGF-like module
Species Human (Homo sapiens) [TaxId:9606] [56457] (5 PDB entries)
Domain d1g1qc1: 1g1q C:1-118 [65088]
Other proteins in same PDB: d1g1qa2, d1g1qb2, d1g1qc2, d1g1qd2

Details for d1g1qc1

PDB Entry: 1g1q (more details), 2.4 Å

PDB Description: Crystal structure of P-selectin lectin/EGF domains

SCOP Domain Sequences for d1g1qc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g1qc1 d.169.1.1 (C:1-118) E-selectin {Human (Homo sapiens)}
wtyhystkayswnisrkycqnrytdlvaiqnkneidylnkvlpyyssyywigirknnktw
twvgtkkaltneaenwadnepnnkrnnedcveiyikspsapgkwndehclkkkhalcy

SCOP Domain Coordinates for d1g1qc1:

Click to download the PDB-style file with coordinates for d1g1qc1.
(The format of our PDB-style files is described here.)

Timeline for d1g1qc1: