Lineage for d1g1qb1 (1g1q B:1-118)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2234637Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2234638Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2234639Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 2234929Protein P-selectin, C-lectin domain [116731] (1 species)
    followed by EGF-like module
  7. 2234930Species Human (Homo sapiens) [TaxId:9606] [116732] (3 PDB entries)
  8. 2234934Domain d1g1qb1: 1g1q B:1-118 [65086]
    Other proteins in same PDB: d1g1qa2, d1g1qa3, d1g1qb2, d1g1qb3, d1g1qc2, d1g1qc3, d1g1qd2, d1g1qd3
    complexed with ca, mrd

Details for d1g1qb1

PDB Entry: 1g1q (more details), 2.4 Å

PDB Description: Crystal structure of P-selectin lectin/EGF domains
PDB Compounds: (B:) p-selectin

SCOPe Domain Sequences for d1g1qb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g1qb1 d.169.1.1 (B:1-118) P-selectin, C-lectin domain {Human (Homo sapiens) [TaxId: 9606]}
wtyhystkayswnisrkycqnrytdlvaiqnkneidylnkvlpyyssyywigirknnktw
twvgtkkaltneaenwadnepnnkrnnedcveiyikspsapgkwndehclkkkhalcy

SCOPe Domain Coordinates for d1g1qb1:

Click to download the PDB-style file with coordinates for d1g1qb1.
(The format of our PDB-style files is described here.)

Timeline for d1g1qb1: