Lineage for d1fzya_ (1fzy A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1021591Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1021592Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1021593Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 1021601Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species)
  7. 1021614Species Baker's yeast (Saccharomyces cerevisiae), ubc1 [TaxId:4932] [69685] (3 PDB entries)
    Uniprot P21734
  8. 1021615Domain d1fzya_: 1fzy A: [65072]

Details for d1fzya_

PDB Entry: 1fzy (more details), 1.9 Å

PDB Description: crystal structure of saccharomyces cerevisiae ubiquitin conjugating enzyme 1
PDB Compounds: (A:) ubiquitin-conjugating enzyme e2-24 kda

SCOPe Domain Sequences for d1fzya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fzya_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc1 [TaxId: 4932]}
srakrimkeiqavkddpaahitlefvsesdihhlkgtflgppgtpyeggkfvvdievpme
ypfkppkmqfdtkvyhpnissvtgaicldilknawspvitlksalislqallqspepndp
qdaevaqhylrdresfnktaalwtrlyas

SCOPe Domain Coordinates for d1fzya_:

Click to download the PDB-style file with coordinates for d1fzya_.
(The format of our PDB-style files is described here.)

Timeline for d1fzya_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1fzyb_