Lineage for d1fyla_ (1fyl A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 438099Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 438531Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (55 families) (S)
    contains a small beta-sheet (wing)
  5. 438816Family a.4.5.22: Heat-shock transcription factor [46873] (1 protein)
  6. 438817Protein Heat-shock transcription factor [46874] (2 species)
  7. 438821Species Milk yeast (Kluyveromyces lactis) [TaxId:28985] [46876] (9 PDB entries)
  8. 438830Domain d1fyla_: 1fyl A: [65068]

Details for d1fyla_

PDB Entry: 1fyl (more details), 2.1 Å

PDB Description: serendipitous crystal structure containing the heat shock transcription factor's dna binding domain and cognate dna in a head- to-head orientation

SCOP Domain Sequences for d1fyla_:

Sequence, based on SEQRES records: (download)

>d1fyla_ a.4.5.22 (A:) Heat-shock transcription factor {Milk yeast (Kluyveromyces lactis)}
rpafvnklwsmvndksnekfihwstsgesivvpnrerfvqevlpkyfkhsnfasfvrqln
mygwhkvqdvksgsmlsnndsrwefenerha

Sequence, based on observed residues (ATOM records): (download)

>d1fyla_ a.4.5.22 (A:) Heat-shock transcription factor {Milk yeast (Kluyveromyces lactis)}
rpafvnklwsmvndksnekfihwstsgesivvpnrerfvqevlpkyfkhsnfasfvrqln
mygwhkvqdvksndsrwefenerha

SCOP Domain Coordinates for d1fyla_:

Click to download the PDB-style file with coordinates for d1fyla_.
(The format of our PDB-style files is described here.)

Timeline for d1fyla_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1fylb_