Lineage for d1fxzc2 (1fxz C:297-470)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 115107Fold b.82: Double-stranded beta-helix [51181] (6 superfamilies)
  4. 115108Superfamily b.82.1: RmlC-like [51182] (4 families) (S)
  5. 115119Family b.82.1.2: Germin/Seed storage 7S protein [51187] (2 proteins)
  6. 115123Protein Seed storage 7S protein [51188] (3 species)
  7. 115158Species Soybean (Glycine max), proglycinin [TaxId:3847] [69345] (1 PDB entry)
  8. 115164Domain d1fxzc2: 1fxz C:297-470 [65064]

Details for d1fxzc2

PDB Entry: 1fxz (more details), 2.8 Å

PDB Description: crystal structure of soybean proglycinin a1ab1b homotrimer

SCOP Domain Sequences for d1fxzc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fxzc2 b.82.1.2 (C:297-470) Seed storage 7S protein {Soybean (Glycine max), proglycinin}
ictmrlrhnigqtsspdiynpqagsvttatsldfpalswlrlsaefgslrknamfvphyn
lnansiiyalngraliqvvncngervfdgelqegrvlivpqnfvvaarsqsdnfeyvsfk
tndtpmigtlagansllnalpeeviqhtfnlksqqarqiknnnpfkflvppqes

SCOP Domain Coordinates for d1fxzc2:

Click to download the PDB-style file with coordinates for d1fxzc2.
(The format of our PDB-style files is described here.)

Timeline for d1fxzc2: