Lineage for d1fxza2 (1fxz A:297-470)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 171721Fold b.82: Double-stranded beta-helix [51181] (6 superfamilies)
  4. 171722Superfamily b.82.1: RmlC-like cupins [51182] (5 families) (S)
  5. 171733Family b.82.1.2: Germin/Seed storage 7S protein [51187] (4 proteins)
  6. 171751Protein Seed storage 7S protein [51188] (4 species)
  7. 171799Species Soybean (Glycine max), proglycinin [TaxId:3847] [69345] (1 PDB entry)
  8. 171801Domain d1fxza2: 1fxz A:297-470 [65060]

Details for d1fxza2

PDB Entry: 1fxz (more details), 2.8 Å

PDB Description: crystal structure of soybean proglycinin a1ab1b homotrimer

SCOP Domain Sequences for d1fxza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fxza2 b.82.1.2 (A:297-470) Seed storage 7S protein {Soybean (Glycine max), proglycinin}
ictmrlrhnigqtsspdiynpqagsvttatsldfpalswlrlsaefgslrknamfvphyn
lnansiiyalngraliqvvncngervfdgelqegrvlivpqnfvvaarsqsdnfeyvsfk
tndtpmigtlagansllnalpeeviqhtfnlksqqarqiknnnpfkflvppqes

SCOP Domain Coordinates for d1fxza2:

Click to download the PDB-style file with coordinates for d1fxza2.
(The format of our PDB-style files is described here.)

Timeline for d1fxza2: