Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) |
Family d.20.1.1: UBC-related [54496] (7 proteins) |
Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species) |
Species Baker's yeast (Saccharomyces cerevisiae), ubc1 [TaxId:4932] [69685] (3 PDB entries) Uniprot P21734 |
Domain d1fxta_: 1fxt A: [65055] Other proteins in same PDB: d1fxtb_ |
PDB Entry: 1fxt (more details)
SCOPe Domain Sequences for d1fxta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fxta_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc1 [TaxId: 4932]} srakrimkeiqavkddpaahitlefvsesdihhlkgtflgppgtpyeggkfvvdievpme ypfkppkmqfdtkvyhpnissvtgaicldilknawspvitlksalislqallqspepndp qdaevaqhylrdresfnktaalwtrlyas
Timeline for d1fxta_: