Lineage for d1fxta_ (1fxt A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 720005Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 720006Superfamily d.20.1: UBC-like [54495] (4 families) (S)
  5. 720007Family d.20.1.1: UBC-related [54496] (6 proteins)
  6. 720015Protein Ubiquitin conjugating enzyme, UBC [54497] (31 species)
  7. 720021Species Baker's yeast (Saccharomyces cerevisiae), ubc1 [TaxId:4932] [69685] (3 PDB entries)
  8. 720024Domain d1fxta_: 1fxt A: [65055]
    Other proteins in same PDB: d1fxtb_

Details for d1fxta_

PDB Entry: 1fxt (more details)

PDB Description: structure of a conjugating enzyme-ubiquitin thiolester complex
PDB Compounds: (A:) ubiquitin-conjugating enzyme e2-24 kda

SCOP Domain Sequences for d1fxta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fxta_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc1 [TaxId: 4932]}
srakrimkeiqavkddpaahitlefvsesdihhlkgtflgppgtpyeggkfvvdievpme
ypfkppkmqfdtkvyhpnissvtgaicldilknawspvitlksalislqallqspepndp
qdaevaqhylrdresfnktaalwtrlyas

SCOP Domain Coordinates for d1fxta_:

Click to download the PDB-style file with coordinates for d1fxta_.
(The format of our PDB-style files is described here.)

Timeline for d1fxta_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1fxtb_