Lineage for d1fs6a_ (1fs6 A:)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.35: Glucosamine 6-phosphate deaminase/isomerase [52511] (1 superfamily) Superfamily c.35.1: Glucosamine 6-phosphate deaminase/isomerase [52512] (1 family) 
Family c.35.1.1: Glucosamine 6-phosphate deaminase/isomerase [52513] (1 protein) Protein Glucosamine 6-phosphate deaminase/isomerase [52514] (2 species) Species Escherichia coli [TaxId:562] [52515] (10 PDB entries) 
Domain d1fs6a_: 1fs6 A: [65046]
Details for d1fs6a_
PDB Entry: 1fs6 (more details), 2.2 Å
PDB Description: glucosamine-6-phosphate deaminase from e.coli, t conformer, at 2.2a resolution
SCOP Domain Sequences for d1fs6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fs6a_ c.35.1.1 (A:) Glucosamine 6-phosphate deaminase/isomerase {Escherichia coli}
mrliplttaeqvgkwaarhivnrinafkptadrpfvlglptggtpmttykalvemhkagq
vsfkhvvtfnmdeyvglpkehpesyysfmhrnffdhvdipaeninllngnapdidaecrq
yeekirsygkihlfmggvgndghiafnepasslasrtriktlthdtrvansrffdndvnq
vpkyaltvgvgtlldaeevmilvlgsqkalalqaavegcvnhmwtisclqlhpkaimvcd
epstmelkvktlryfneleaenikgl
SCOP Domain Coordinates for d1fs6a_:
Click to download the PDB-style file with coordinates for d1fs6a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fs6a_:
- d1fs6a_ is new in SCOP 1.59
- d1fs6a_ appears in SCOP 1.61
- d1fs6a_ appears in the current release, SCOPe 2.08
View in 3D