Lineage for d1fs5b_ (1fs5 B:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 242708Fold c.35: Phosphosugar isomerase [52511] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 242709Superfamily c.35.1: Phosphosugar isomerase [52512] (2 families) (S)
    share a common phosphate-binding site
  5. 242710Family c.35.1.1: Glucosamine 6-phosphate deaminase/isomerase [52513] (1 protein)
  6. 242711Protein Glucosamine 6-phosphate deaminase/isomerase [52514] (2 species)
  7. 242712Species Escherichia coli [TaxId:562] [52515] (10 PDB entries)
  8. 242714Domain d1fs5b_: 1fs5 B: [65045]
    complexed with 16g, tar

Details for d1fs5b_

PDB Entry: 1fs5 (more details), 1.73 Å

PDB Description: a discovery of three alternate conformations in the active site of glucosamine-6-phosphate isomerase

SCOP Domain Sequences for d1fs5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fs5b_ c.35.1.1 (B:) Glucosamine 6-phosphate deaminase/isomerase {Escherichia coli}
mrliplttaeqvgkwaarhivnrinafkptadrpfvlglptggtpmttykalvemhkagq
vsfkhvvtfnmdeyvglpkehpesyysfmhrnffdhvdipaeninllngnapdidaecrq
yeekirsygkihlfmggvgndghiafnepasslasrtriktlthdtrvansrffdndvnq
vpkyaltvgvgtlldaeevmilvlgsqkalalqaavegcvnhmwtisclqlhpkaimvcd
epstmelkvktlryfneleaenikgl

SCOP Domain Coordinates for d1fs5b_:

Click to download the PDB-style file with coordinates for d1fs5b_.
(The format of our PDB-style files is described here.)

Timeline for d1fs5b_: