Lineage for d1frza_ (1frz A:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 121534Fold c.35: Glucosamine 6-phosphate deaminase/isomerase [52511] (1 superfamily)
  4. 121535Superfamily c.35.1: Glucosamine 6-phosphate deaminase/isomerase [52512] (1 family) (S)
  5. 121536Family c.35.1.1: Glucosamine 6-phosphate deaminase/isomerase [52513] (1 protein)
  6. 121537Protein Glucosamine 6-phosphate deaminase/isomerase [52514] (2 species)
  7. 121538Species Escherichia coli [TaxId:562] [52515] (10 PDB entries)
  8. 121547Domain d1frza_: 1frz A: [65041]

Details for d1frza_

PDB Entry: 1frz (more details), 2.2 Å

PDB Description: glucosamine-6-phosphate deaminase from e.coli, r conformer. complexed with the allosteric activator n-acetyl-glucosamine-6-phosphate at 2.2 a resolution

SCOP Domain Sequences for d1frza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1frza_ c.35.1.1 (A:) Glucosamine 6-phosphate deaminase/isomerase {Escherichia coli}
mrliplttaeqvgkwaarhivnrinafkptadrpfvlglptggtpmttykalvemhkagq
vsfkhvvtfnmdeyvglpkehpesyysfmhrnffdhvdipaeninllngnapdidaecrq
yeekirsygkihlfmggvgndghiafnepasslasrtriktlthdtrvansrffdndvnq
vpkyaltvgvgtlldaeevmilvlgsqkalalqaavegcvnhmwtisclqlhpkaimvcd
epstmelkvktlryfneleaenikgl

SCOP Domain Coordinates for d1frza_:

Click to download the PDB-style file with coordinates for d1frza_.
(The format of our PDB-style files is described here.)

Timeline for d1frza_: