Lineage for d1fqob_ (1fqo B:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 121534Fold c.35: Glucosamine 6-phosphate deaminase/isomerase [52511] (1 superfamily)
  4. 121535Superfamily c.35.1: Glucosamine 6-phosphate deaminase/isomerase [52512] (1 family) (S)
  5. 121536Family c.35.1.1: Glucosamine 6-phosphate deaminase/isomerase [52513] (1 protein)
  6. 121537Protein Glucosamine 6-phosphate deaminase/isomerase [52514] (2 species)
  7. 121538Species Escherichia coli [TaxId:562] [52515] (10 PDB entries)
  8. 121546Domain d1fqob_: 1fqo B: [65040]

Details for d1fqob_

PDB Entry: 1fqo (more details), 2.2 Å

PDB Description: glucosamine 6-phosphate deaminase complexed with the substrate of the reverse reaction fructose 6-phosphate (open form)

SCOP Domain Sequences for d1fqob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fqob_ c.35.1.1 (B:) Glucosamine 6-phosphate deaminase/isomerase {Escherichia coli}
mrliplttaeqvgkwaarhivnrinafkptadrpfvlglptggtpmttykalvemhkagq
vsfkhvvtfnmdeyvglpkehpesyysfmhrnffdhvdipaeninllngnapdidaecrq
yeekirsygkihlfmggvgndghiafnepasslasrtriktlthdtrvansrffdndvnq
vpkyaltvgvgtlldaeevmilvlgsqkalalqaavegcvnhmwtisclqlhpkaimvcd
epstmelkvktlryfneleaenikgl

SCOP Domain Coordinates for d1fqob_:

Click to download the PDB-style file with coordinates for d1fqob_.
(The format of our PDB-style files is described here.)

Timeline for d1fqob_: