SCOP 1.59: Domain d1fl6l2: 1fl6 L:108-212

Lineage for d1fl6l2 (1fl6 L:108-212)

Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
Superfamily b.1.1: Immunoglobulin [48726] (6 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)
Species Sulfide oxidase catalytic Fab 28b4 germline precursor, (mouse/human?), kappa L chain [69150] (2 PDB entries)
Domain d1fl6l2: 1fl6 L:108-212 [65030]
Other proteins in same PDB: d1fl6a1, d1fl6b1, d1fl6h1, d1fl6l1

Details for d1fl6l2

PDB Entry: 1fl6 (more details), 2.8 Å

PDB Description: the hapten complexed germline precursor to sulfide oxidase catalytic antibody 28b4

SCOP Domain Sequences for d1fl6l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fl6l2 b.1.1.2 (L:108-212) Immunoglobulin (constant domains of L and H chains) {Sulfide oxidase catalytic Fab 28b4 germline precursor, (mouse/human?), kappa L chain}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

SCOP Domain Coordinates for d1fl6l2:

Click to download the PDB-style file with coordinates for d1fl6l2.
(The format of our PDB-style files is described here.)

Timeline for d1fl6l2: