Lineage for d1fl6h1 (1fl6 H:1-113)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1510447Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1510705Species Mouse (Mus musculus), cluster 1 [TaxId:10090] [88548] (57 PDB entries)
    Uniprot P01796 # ! HV27_MOUSE Ig heavy chain V-III region A4
  8. 1510761Domain d1fl6h1: 1fl6 H:1-113 [65027]
    Other proteins in same PDB: d1fl6a1, d1fl6a2, d1fl6b2, d1fl6h2, d1fl6l1, d1fl6l2
    part of humanized catalytic Fab 28b4 with a sulfide oxidase activity
    complexed with aah

Details for d1fl6h1

PDB Entry: 1fl6 (more details), 2.8 Å

PDB Description: the hapten complexed germline precursor to sulfide oxidase catalytic antibody 28b4
PDB Compounds: (H:) antibody germline precursor to 28b4

SCOPe Domain Sequences for d1fl6h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fl6h1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]}
qvqlvesggglvqpggslrlscatsgftftdyymswvrqppgkalewlgfirnkangytt
eysasvkgrftisrdnsqsilylqmntlraedsatyycardgsyamdywgqgtsvtvss

SCOPe Domain Coordinates for d1fl6h1:

Click to download the PDB-style file with coordinates for d1fl6h1.
(The format of our PDB-style files is described here.)

Timeline for d1fl6h1: