SCOP 1.63: Domain d1fl6h1: 1fl6 H:1-113

Lineage for d1fl6h1 (1fl6 H:1-113)

Root: SCOP 1.63
Class b: All beta proteins [48724] (119 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
Species Sulfide oxidase catalytic Fab 28b4 germline precursor, (mouse/human?), kappa L chain [69139] (2 PDB entries)
Domain d1fl6h1: 1fl6 H:1-113 [65027]
Other proteins in same PDB: d1fl6a2, d1fl6b2, d1fl6h2, d1fl6l2

Details for d1fl6h1

PDB Entry: 1fl6 (more details), 2.8 Å

PDB Description: the hapten complexed germline precursor to sulfide oxidase catalytic antibody 28b4

SCOP Domain Sequences for d1fl6h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fl6h1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {Sulfide oxidase catalytic Fab 28b4 germline precursor, (mouse/human?), kappa L chain}
qvqlvesggglvqpggslrlscatsgftftdyymswvrqppgkalewlgfirnkangytt
eysasvkgrftisrdnsqsilylqmntlraedsatyycardgsyamdywgqgtsvtvss

SCOP Domain Coordinates for d1fl6h1:

Click to download the PDB-style file with coordinates for d1fl6h1.
(The format of our PDB-style files is described here.)

Timeline for d1fl6h1: