Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species) |
Species Sulfide oxidase catalytic Fab 28b4 germline precursor, (mouse/human?), kappa L chain [69139] (2 PDB entries) |
Domain d1fl6h1: 1fl6 H:1-113 [65027] Other proteins in same PDB: d1fl6a2, d1fl6b2, d1fl6h2, d1fl6l2 |
PDB Entry: 1fl6 (more details), 2.8 Å
SCOP Domain Sequences for d1fl6h1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fl6h1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {Sulfide oxidase catalytic Fab 28b4 germline precursor, (mouse/human?), kappa L chain} qvqlvesggglvqpggslrlscatsgftftdyymswvrqppgkalewlgfirnkangytt eysasvkgrftisrdnsqsilylqmntlraedsatyycardgsyamdywgqgtsvtvss
Timeline for d1fl6h1: