SCOP 1.61: Domain d1fl5l2: 1fl5 L:108-212

Lineage for d1fl5l2 (1fl5 L:108-212)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)

7. Species Sulfide oxidase catalytic Fab 28b4 germline precursor, (mouse/human?), kappa L chain [69150] (2 PDB entries)

8. Domain d1fl5l2: 1fl5 L:108-212 [65022]
   Other proteins in same PDB: d1fl5a1, d1fl5b1, d1fl5h1, d1fl5l1

Details for d1fl5l2

PDB Entry: 1fl5, 2.1 Å

PDB Description: the unliganded germline precursor to the sulfide oxidase catalytic antibody 28b4.

SCOP Domain Sequences for d1fl5l2:

Sequence; same for both SEQRES and ATOM records:

>d1fl5l2 b.1.1.2 (L:108-212) Immunoglobulin (constant domains of L and H chains) {Sulfide oxidase catalytic Fab 28b4 germline precursor, (mouse/human?), kappa L chain}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

Timeline for d1fl5l2:

• d1fl5l2 first appeared in SCOP 1.59
  
• d1fl5l2 appears in SCOP 1.63
  
• d1fl5l2 appears in the current release, SCOPe 2.08