Lineage for d1fl5b2 (1fl5 B:114-213)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 221939Species Sulfide oxidase catalytic Fab 28b4 germline precursor, (mouse/human?), kappa L chain [69150] (2 PDB entries)
  8. 221941Domain d1fl5b2: 1fl5 B:114-213 [65018]
    Other proteins in same PDB: d1fl5a1, d1fl5b1, d1fl5h1, d1fl5l1
    complexed with so4; mutant

Details for d1fl5b2

PDB Entry: 1fl5 (more details), 2.1 Å

PDB Description: the unliganded germline precursor to the sulfide oxidase catalytic antibody 28b4.

SCOP Domain Sequences for d1fl5b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fl5b2 b.1.1.2 (B:114-213) Immunoglobulin (constant domains of L and H chains) {Sulfide oxidase catalytic Fab 28b4 germline precursor, (mouse/human?), kappa L chain}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

SCOP Domain Coordinates for d1fl5b2:

Click to download the PDB-style file with coordinates for d1fl5b2.
(The format of our PDB-style files is described here.)

Timeline for d1fl5b2: