Lineage for d1fl5a1 (1fl5 A:1-107)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 157354Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 157410Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)
  7. 158637Species Sulfide oxidase catalytic Fab 28b4 germline precursor, (mouse/human?), kappa L chain [69139] (2 PDB entries)
  8. 158638Domain d1fl5a1: 1fl5 A:1-107 [65015]
    Other proteins in same PDB: d1fl5a2, d1fl5b2, d1fl5h2, d1fl5l2

Details for d1fl5a1

PDB Entry: 1fl5 (more details), 2.1 Å

PDB Description: the unliganded germline precursor to the sulfide oxidase catalytic antibody 28b4.
PDB Compounds: (A:)

SCOP Domain Sequences for d1fl5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fl5a1 b.1.1.1 (A:1-107) Immunoglobulin (variable domains of L and H chains) {Sulfide oxidase catalytic Fab 28b4 germline precursor, (mouse/human?), kappa L chain}
elvmtqtplslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvprtfgggtkleik

SCOP Domain Coordinates for d1fl5a1:

Click to download the PDB-style file with coordinates for d1fl5a1.
(The format of our PDB-style files is described here.)

Timeline for d1fl5a1: